PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00779_0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 623aa    MW: 66158.7 Da    PI: 8.1724
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00779_0010genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.9e-1696144148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48 
                      +g+W+teEd ll+++v+++G+++W  I r +   +R++k+c++rw ++l
    kfl00779_0010  96 KGAWSTEEDALLLQYVQEHGSKNWGNIQRVIRgFKRCGKSCRLRWVNHL 144
                      79*******************************66***********996 PP

2Myb_DNA-binding40.56.2e-13154192545
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +E+ + +++++ +G++ W++Ia++++ gRt++ +k++w+
    kfl00779_0010 154 SRDEERRVLELHATHGNK-WAKIAAELP-GRTDNKVKNFWN 192
                      779***************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.16191144IPR017930Myb domain
SuperFamilySSF466891.95E-2594191IPR009057Homeodomain-like
SMARTSM007172.9E-1395146IPR001005SANT/Myb domain
PfamPF002492.2E-1596144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-1997151IPR009057Homeodomain-like
CDDcd001672.14E-1298144No hitNo description
PROSITE profilePS5129420.671145199IPR017930Myb domain
SMARTSM007178.0E-12149197IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-18152197IPR009057Homeodomain-like
CDDcd001671.06E-9154192No hitNo description
PfamPF002498.1E-12154192IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MFPPLSGSQA ERVYQLAAAH RLLTSPPAGG PTRSRYNDAA ASLSCCEPLL RTPIPAQGPQ  60
RGGPKWHNRA AVVTPSESCS SASSEVQQAD AGGLVKGAWS TEEDALLLQY VQEHGSKNWG  120
NIQRVIRGFK RCGKSCRLRW VNHLRGGLKK TALSRDEERR VLELHATHGN KWAKIAAELP  180
GRTDNKVKNF WNGRQKRIIR AKQLAARPAS GGQALPRSLP CQAPTAARPW MARMAGRPTS  240
SSSSHPWAPP PRLPAISRGF WLPPLVIPEV PPLEEDDNEG ATPPGQPACP SPPPLALPEG  300
ALGSSLYPSY RYAPPLPQAW RQAGPPQAWG PQDQGWTPLS VRLPNTLSPP PKPPVVRAAT  360
PNVDAFLISP SEADEDGFLH DGRDSAPVPQ PPSRKRSRAE SFLAGDAGNM ALADAWRWGP  420
VHDGELLWDG GSETVGPGVG QSLKRSKMEE SEGECEWGIS FNTPGGCSGE GTKPQTRATA  480
WPATSGFATF TLVVTSPLYA ACSCLTLGAP APSCADALSS CLLPAPLSSP GPSSWPAWLD  540
EASPRHRLEV EAAAASLYPT ATAFLASVQP DWGAPAGEAA LQWALPPLVP VDELGACVGE  600
DGQGERLKKI ASWSNFLCAA AGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26941975106B-MYB
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.17e-38myb domain protein 81